<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24478
Description |
Uncharacterized protein |
Sequence | VVHNMALSISGPRELTGAVDLISQYKLEPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPPSIKPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDRKKDKHHEKKRKHEGTEDSADVHKHKKSKVMYNYYLLPGTTNFLAAHFVGLLT |
Length | 213 |
Position | Head |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.179 |
Instability index | 31.97 |
Isoelectric point | 9.46 |
Molecular weight | 24587.73 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24478
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.33| 17| 17| 129| 145| 1
---------------------------------------------------------------------------
117- 136 (26.22/ 9.19) KPKSESKDKekkHK.KHKDKD
137- 156 (22.37/ 6.90) KDREHKKHK.hrHKdRSKDKD
157- 173 (29.73/11.28) KDKDRKKDK...HH.EKKRKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.88| 16| 18| 65| 80| 2
---------------------------------------------------------------------------
65- 80 (28.10/19.22) ELDQLVQNAYLRDKPP
86- 101 (27.78/18.94) DMETLGQAFQLRETAP
---------------------------------------------------------------------------
|