<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24460
Description |
Uncharacterized protein |
Sequence | TIHAGRGGRGFGGRSDGGGRGGRGFGGRSDGGGRGGRGGRTPRGRGRGGGGRGGPGMKGGSKVVVVPHKHDGVFIAKAKEDALCTKNMVAGESVYGEKRVSVQNEDGTKVEYRVWNPFRSKLAAAVLGGVDNIWIAPGARVLYLGAASGTTVSHVSDIVGPTGLVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKNGGHFVISIKANCIDSTQAPEAVFAAEVEKLKLEQFKPSEQVTLEPFERDHACVVGGYRMPKKPKPATI |
Length | 302 |
Position | Unknown |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.321 |
Instability index | 31.47 |
Isoelectric point | 9.97 |
Molecular weight | 31946.08 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
Repeats |
>MDP24460
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.02| 14| 16| 18| 33| 1
---------------------------------------------------------------------------
6- 22 (23.97/ 6.25) R..GGRGFGGrsDgGGRGG
23- 39 (24.05/11.02) RgfGGRSDGG..GrGGRGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.27| 14| 17| 191| 204| 2
---------------------------------------------------------------------------
191- 204 (25.29/18.55) IIEDARHPAKYRML
211- 224 (23.99/17.25) IFSDVAQPDQARIL
---------------------------------------------------------------------------
|