<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24434
Description |
Uncharacterized protein |
Sequence | MDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPEGPASQPQAPPAPGAPAAAPLPPQPPQARPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQEKHSQLYKMATCNLQLYICYFHLDVVSL |
Length | 153 |
Position | Middle |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.309 |
Instability index | 74.93 |
Isoelectric point | 5.04 |
Molecular weight | 16635.90 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24434
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.29| 18| 25| 28| 51| 1
---------------------------------------------------------------------------
28- 46 (32.15/22.46) DAPPVRlSNSYPDPLNPNP
56- 73 (36.14/10.94) QAPPAP.GAPAAAPLPPQP
---------------------------------------------------------------------------
|