| Description | Uncharacterized protein |
| Sequence | PELVRPPESRKKQRGGRRSEEEEGSAMDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPEGPASQPQAPPAPGAPAAAPLPPQPPQARPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQGRERSCGIGASETT |
| Length | 165 |
| Position | Middle |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.713 |
| Instability index | 89.62 |
| Isoelectric point | 5.12 |
| Molecular weight | 17645.67 |
| Publications | PubMed=25035499 PubMed=29158546 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP24431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.29| 18| 25| 54| 77| 1
---------------------------------------------------------------------------
54- 72 (32.15/19.39) DAPPVRlSNSYPDPLNPNP
82- 99 (36.14/ 9.33) QAPPAP.GAPAAAPLPPQP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LKRIQEL 2) PELVR 3) QARPQPALDLA | 144 1 101 | 150 5 111 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab