<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24429
Description |
Uncharacterized protein |
Sequence | PELVRPPESRKKQRGGRRSEEEEGSAMDIISQLQEQLNEMAMVAVNTFGTLQRDAPPVRLSNSYPDPLNPNPNPEGPASQPQAPPAPGAPAAAPLPPQPPQARPQPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAGNIFEFRTSYHGIAD |
Length | 183 |
Position | Middle |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.630 |
Instability index | 81.21 |
Isoelectric point | 4.88 |
Molecular weight | 19772.02 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.29| 18| 25| 54| 77| 1
---------------------------------------------------------------------------
54- 72 (32.15/18.11) DAPPVRlSNSYPDPLNPNP
82- 99 (36.14/ 8.69) QAPPAP.GAPAAAPLPPQP
---------------------------------------------------------------------------
|