<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24424

Description Uncharacterized protein
SequenceQIKSLKDQYFAELSELFNKISVKLQHVDSIIPPQKPSEQYDRMKSFKIMLERILQMLQISKSTIQPAMRDKVPQYEKQIISILNSQRRKPVQPQIQQHFQPPAGQAPNSSISQQQQPSQTLQQHDSHTNPQASLSSMSTGLQSSSAAGIQHVPAPPTKNFSAPTQQNGANIQHQADSNLETAQGGNFNSLQHGSVSSALQQGSTVPMQGTMNTQLQTSSSMLSHNSMSTMQPNGNSMQANASSFQQLKQQQQDHQMMQSQQMKRQMFQQYQQKQQMLQQQLPVQQHLQKQQPVQMQIPQLHAGNDVNELKVRQGTAMKPGMYQQHLGQRSNYYHQQLKQSGAFPISSPQNNLQASSPQISHHSPQVDQHNPLPSQVKTGTPLHSANSPFVPSPSPSIAPSPIPVDSAKPHSNISSLTNTGQAGHQQTSLVPQTQSIAVNTPGISASPLLAEFTSVDGSQANMLTQAPTKSSAVERPLDRLLKALRTTQRESLNAAVSDIRSVVSMIDRIAGSAPGNGSRAAVGEDLVAMTKCRLQARNFITNDGSGASKKMKRDTSAMPLNVSSAGSVNDSFKQTFSVDTPDLQSTATSQAKWQKIEVNHALLEEIQEINQQLIDTELHVCEDDAESFAGTCEGAEGTVIKCTFTAVAVSPSLKSIFASAQMSPIMPLRLLVPASYPKCSPVLLDKSPDEQRNSEDLSMKAKSKFSILLRGLAEPMSLREIARTWDACARKTIAEYAQKTGGGSFSSSYGCWENCVGA
Length758
PositionTail
OrganismAegilops tauschii subsp. strangulata (Goatgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
Aromaticity0.04
Grand average of hydropathy-0.595
Instability index60.93
Isoelectric point9.04
Molecular weight82726.10
Publications
PubMed=25035499
PubMed=29158546

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24424
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.43|      21|      24|     244|     265|       1
---------------------------------------------------------------------------
  244-  261 (22.04/10.70)	.....FQQLKQQQQDHqMMQSQQ
  262-  280 (31.13/12.29)	MKRQmFQQYQQKQQ...MLQ.QQ
  317-  336 (27.26/ 9.80)	MKPGmYQQHLGQRSNY...YHQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.86|      22|      24|      84|     106|       2
---------------------------------------------------------------------------
   84-  106 (33.83/15.40)	NS...QRRKPVQPqIQQHFQPPAGQA
  108-  132 (30.03/ 9.79)	NSsisQQQQPSQT.LQQHDSHTNPQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.91|      13|      21|     171|     188|       3
---------------------------------------------------------------------------
  149-  161 (23.51/10.10)	IQH.....VPAPPTKNFS
  171-  188 (19.40/17.53)	IQHqadsnLETAQGGNFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     128.50|      28|      28|     344|     371|       4
---------------------------------------------------------------------------
  206-  233 (37.47/17.69)	P....MqGTMNTQLQTSSSMLSHNSMSTMQPN.
  344-  371 (52.68/28.68)	P....I.SSPQNNLQASSPQISHHSPQVDQHNP
  373-  401 (38.35/18.33)	PsqvkT.GTPLHS..ANSPFVPSPSPSI.APSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.09|      30|      32|     409|     439|       6
---------------------------------------------------------------------------
  409-  439 (49.14/25.63)	PHSNISSLTN..TGQAGHQQTSLV..PqTQSIAVN
  441-  474 (41.95/17.86)	PGISASPLLAefTSVDGSQANMLTqaP.TKSSAVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.53|      28|      32|       9|      40|       7
---------------------------------------------------------------------------
   13-   40 (47.58/34.62)	LSELFNKISVKLQHVDSIIPP..QKPSEQY
   46-   75 (42.95/20.80)	FKIMLERILQMLQISKSTIQPamRDKVPQY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24424 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SVDGSQANMLTQAPTKSSAVERPLDRLLKALRT
2) YEKQIISILNSQRRKPVQPQIQQHFQPPAGQAPNSSISQQQQPSQTLQQHDSHTNPQASLSSMSTGLQSSSAAGIQHVPAPPTKNFSAPTQQNGANIQHQADSNLETAQGGNFNSLQHGSVSSALQQGSTVPMQGTMNTQLQTSSSMLSHNSMSTMQPNGNSMQANASSFQQLKQQQQDHQMMQSQQMKRQMFQQYQQKQQMLQQQLPVQQHLQKQQPVQMQIPQLHAGNDVNELKVRQGTAMKPGMYQQHLGQRSNYYHQQLKQSGAFPISSPQNNLQASSPQISHHSPQVDQHNPLPSQVKTGTPLHSANSPFVPSPSPSIAPSPIPVDSAKPHSNISSLTNTGQAGHQQTSLVPQTQSIA
454
75
486
437










Molecular Recognition Features






MoRF SequenceStartStop




NANANA