<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24395

Description Uncharacterized protein
SequenceGGNHLPTRRSLPPRPPRVASIQANRSRPSPLPHQSRSRGSRWRPWATTSGWTWTSSPSSASRPSTRPATSTTRRTPAARSSGWRPSAGSTSPGSSSGTPRRPRRRRPRTPPRRPGPGRASTRACSSRSRSSPSSSTSSPRSRRMTPWPSPPFPSPGRCRTKSSSTWPSPPPPSSSGFGHLGRYFKQSAKTMQQQFQKEARFYGSLIRLQQNWKVKRQRGNAPGINSFMFDVVDTSQLDTAAMPRMSSLSLVQIDQDSSGTLSVQVPQKACRFLSLQFRRDSANGPESYACRTKGVSSTTSSAAEDDALEEDDVNKSVKQAHSILRNIHKSIFEEQVLDMVIRETFVQTQGVNVTGMREDFLQLAIGEESLLCLSLVDSGQDSDSEMAGHEHNNSEANLVLATTNGKQEPLKRDTSGFLNPKSLEIYLLHLFHENILRKVREKYRNIVRYQSPAQTAESAGEDSGLLSHFCMTVAHKTYSKKVQLELESVVSRVPYLQLRSLPTWHSRTSSWSLCLRVPQPILAADRPTKPSDNGEPKYKSSRTRFNTKIVLKDGQISLLGEGSPSIAGSLTRKPSDGYLINSYNCDLEDLPTMVLQQVASQIINWLHEEALVLGMSVTRDFLCLYFDLEHGDTLGLVAHVDPDDEYGCISWYLTVDHPAEDDGKAPAADDPWAEKRRFLGYLSLEVLYSTLLDLINLCGTGARPLR
Length706
PositionHead
OrganismAegilops tauschii subsp. strangulata (Goatgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
Aromaticity0.07
Grand average of hydropathy-0.650
Instability index70.55
Isoelectric point9.71
Molecular weight78374.16
Publications
PubMed=25035499
PubMed=29158546

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24395
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     150.96|      19|      22|     147|     165|       1
---------------------------------------------------------------------------
   53-   82 (23.86/ 6.28)	WTSSP.SSA......SRPSTRpatsttrrtpaaRSSG
  108-  126 (30.71/10.32)	RTPPRRPGP......GRASTR............ACSS
  131-  146 (24.16/ 6.45)	SPSSSTSSP.........RSR............RMTP
  147-  165 (42.66/17.36)	WPSPPFPSP......GRCRTK............SSST
  166-  190 (29.56/ 9.64)	WPSPPPPSSsgfghlGRYFKQ............SAKT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.95|      16|      22|     250|     271|       2
---------------------------------------------------------------------------
  250-  271 (20.34/25.57)	LvQIDQDSSGTlsvqvPQK.ACR
  275-  291 (26.61/14.49)	L.QFRRDSANG.....PESyACR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     122.90|      41|     249|     339|     385|       5
---------------------------------------------------------------------------
  339-  385 (56.31/62.09)	MVIREtfVQTQ............GVNVTgmrEDFLQLAIGEESLLCLSLVdSGQDSDSE
  593-  645 (66.59/48.23)	MVLQQ..VASQiinwlheealvlGMSVT...RDFLCLYFDLEHGDTLGLV.AHVDPDDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.05|      13|      42|     520|     532|       8
---------------------------------------------------------------------------
  520-  532 (24.34/13.83)	PILAADRPTKPSD
  564-  576 (23.71/13.27)	PSIAGSLTRKPSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.16|      15|      23|      67|      85|       9
---------------------------------------------------------------------------
   67-   85 (24.35/ 9.27)	PATST.TRRTPAArssgWRP
   92-  107 (25.81/10.25)	PGSSSgTPRRPRR....RRP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24395 with Med17 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GGNHLPTRRSLPPRPPRVASIQANRSRPSPLPHQSRSRGSRWRPWATTSGWTWTSSPSSASRPSTRPATSTTRRTPAARSSGWRPSAGSTSPGSSSGTPRRPRRRRPRTPPRRPGPGRASTRACSSRSRSSPSSSTSSPRSRRMTPWPSPPFPSPGRCRTKSSSTWPSPPPPSSSGFGHLGRYFKQSAKTMQQQFQ
1
196










Molecular Recognition Features






MoRF SequenceStartStop




NANANA