<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24384
Description |
Uncharacterized protein |
Sequence | CYLRVIATAITYFRRVYTRKSMTEYDPRLVAPACLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLQLLQDAGITDLTQFAWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTSWFEELRVDMNIVKNISMEILDFYDTYKIDPQRGLQEDKIIPVMNKLPSKA |
Length | 201 |
Position | Kinase |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.12 |
Grand average of hydropathy | 0.016 |
Instability index | 49.48 |
Isoelectric point | 5.56 |
Molecular weight | 23625.51 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24384
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.84| 37| 85| 62| 105| 1
---------------------------------------------------------------------------
62- 105 (56.42/45.30) DDKYRFEikdILEMEMKL.....LEALDYylvvYHPYR..PLLQLLQDAGI
148- 191 (57.42/31.08) DTTSWFE...ELRVDMNIvknisMEILDF....YDTYKidPQRGLQEDKII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.28| 15| 101| 25| 39| 2
---------------------------------------------------------------------------
4- 15 (14.31/ 6.14) ...RVIATAITYFRR
25- 39 (28.94/19.41) YDPRLVAPACLYLAS
128- 142 (30.02/20.39) YPPYMIALACIYIAS
---------------------------------------------------------------------------
|