<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24375

Description Uncharacterized protein
SequenceMDGGHGQRQPLSPAIPASAVLPHQRQMQLLQHPARPAIADLFTLYLGVNSKQRDEDPARETSNKLQKRVSAHNRDLPPRDEQFISDFEQLCVPFQDQEQLQAVTESVLISFVLQCSSHAPQSQFLLFATRCLCARGHLRWDSLIPSLLSVVSSAEAPMGQGGSVTVGGPVSSSSAIAVPNAPSFHASNPTSPLSAMNTIGSPTQSGIDQPVGANVSPMKAAEFSTLGQPGTTSRGDQSHRGAQVSYLHHLSCRIILAGLESNLKPATHAVIFHHMVNWLVNWDQRPHGVDEADTVQTSRIGRPVHEWMHLCLDVIWILVDEEKCRIPFYELVRSNLQFLENIPDDDAVICIIMEIHRRRDMVCMHMQMLDQHLHCPTFGTHRFLSQSYPSIAGESVANLRYSPITYPSVLGEPLHGEDLANSIPKGGLDWERALRCLRHALRTTPSPDWWRRVLLVAPCYRSHSQTSTPGAVFSPDMIGEAVADRTIELLKLTNSETQCWQDWLLFADIFFFLMKSGCIDFLDFVDKLASRVTNGDQQILRSNHVTWLLAQIIRIEIVMNTLSSDPRKVETTRKIISFHKEDKSLDPNNISPQSILLDFISSSQTLRIWSFNTSIREHLNSDQLQKGKQIDEWWKQMTKASGERMIDFMNLDERAMGMFWVLSFTMAQPACDAVMTWFTSAGGAEFMQGPNMQPNERVTMMHETYPLSMVLLSGLSINLCLKLAYQLEETIFLGQAVPSIAMVETYVRLLLITPHSLFRPHFTTLTQRSPSILSKSGVSLLLLEILNYRLLPLYRCITEKARH
Length803
PositionTail
OrganismAegilops tauschii subsp. strangulata (Goatgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
Aromaticity0.07
Grand average of hydropathy-0.152
Instability index49.30
Isoelectric point6.33
Molecular weight90294.57
Publications
PubMed=25035499
PubMed=29158546

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP24375
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.28|      14|      17|     169|     182|       1
---------------------------------------------------------------------------
  169-  182 (24.27/14.22)	PVSSSSAIAVPNAP
  189-  202 (26.00/15.76)	PTSPLSAMNTIGSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.64|      13|      17|     382|     394|       3
---------------------------------------------------------------------------
  382-  394 (24.35/13.31)	RFLSQSYPSIAGE
  400-  412 (25.28/14.07)	RYSPITYPSVLGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.56|      14|      27|     203|     216|       6
---------------------------------------------------------------------------
  203-  216 (25.69/16.93)	TQSGIDQP..........VGANVS
  222-  245 (17.87/ 9.46)	EFSTLGQPgttsrgdqshRGAQVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.93|      16|      23|     430|     445|       7
---------------------------------------------------------------------------
  430-  445 (32.24/20.23)	WERAL...RCLR.HALRTTP
  450-  469 (24.69/13.83)	WRRVLlvaPCYRsHSQTSTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.75|      12|      27|     289|     306|       9
---------------------------------------------------------------------------
  289-  306 (12.34/21.19)	VDEadtvQTSRIgrPVHE
  319-  330 (24.41/13.59)	VDE....EKCRI..PFYE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     181.90|      53|     378|     113|     165|      11
---------------------------------------------------------------------------
  113-  165 (93.09/57.92)	LQCSSHAPQSQFLLFATR..CLCARGHLRWDSLIPSLLSVVSSAEAPMGQGGSVT
  492-  546 (88.81/54.93)	LTNSETQCWQDWLLFADIffFLMKSGCIDFLDFVDKLASRVTNGDQQILRSNHVT
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP24375 with Med23 domain of Kingdom Viridiplantae

Unable to open file!