<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24363

Description Uncharacterized protein
SequenceMGQGGSVTVGGPVSSSSAIAVPNAPSFHASNPTSPLSAMNTIGSPTQSGIDQPVGANVSPMKAAEFSTLGQPGTTSRGDQSHRGAQVSYLHHLSCRIILAGLESNLKPATHAVIFHHMVNWLVNWDQRPHGVDEADTVQTSRIGRPVHEWMHLCLDVIWILVDEEKCRIPFYELVRSNLQFLENIPDDDAVICIIMEIHRRRDMVCMHMQMLDQHLHCPTFGTHRFLSQSYPSIAGESVANLRYSPITYPSVLGEPLHGEDLANSIPKGGLDWERALRCLRHALRTTPSPDWWRRVLLVAPCYRSHSQTSTPGAVFSPDMIGEAVADRTIELLKLTNSETQCWQDWLLFADIFFFLMKSGCIDFLDFVDKLASRVTNGDQQILRSNHVTWLLAQIIRIEIVMNTLSSDPRKVETTRKIISFHKEDKSLDPNNISPQSILLDFISSSQTLRIWSFNTSIREHLNSDQLQKGKQIDEWWKQMTKASGERMIDFMNLDERAMGMFWVLSFTMAQPACDAVMTWFTSAGGAEFMQGPNMQPNERVTMMHETYPLSMVLLSGLSINLCLKLAYQLEETIFLGQAVPSIAMVETYVRLLLITPHSLFRPHFTTLTQRSPSILSKSGVSLLLLEILNYRLLPLYRYHGKSKALMYDVTKIISMIKGKRGEHRLFRLAENLCMNLILSLRDFFLVKKELKGPTEFTETLNRITIISLAITIKTRGIAEVEHMVYLQPLLEQIMATSQHTWSEKTLRYFPPLIRDFLTVRADKRGQAIQAWQQAETTVINQCNQLLSPSAEPNYVMTYLSHSFPQHRRYLCAGAWMLMNGHPEINSANLV
Length831
PositionTail
OrganismAegilops tauschii subsp. strangulata (Goatgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
Aromaticity0.08
Grand average of hydropathy-0.117
Instability index41.53
Isoelectric point7.02
Molecular weight94129.59
Publications
PubMed=25035499
PubMed=29158546

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP24363
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.98|       8|      70|     202|     246|       5
---------------------------------------------------------------------------
  230-  237 (16.58/45.02)	SYPSIAGE
  248-  255 (15.39/13.76)	TYPSVLGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.81|      14|      23|     275|     288|       9
---------------------------------------------------------------------------
  275-  288 (26.77/13.88)	RAL...RCLR.HALRTTP
  295-  312 (19.04/ 8.06)	RVLlvaPCYRsHSQTSTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.48|      19|      27|      41|      59|      10
---------------------------------------------------------------------------
   41-   59 (36.31/24.15)	TIGSP.TQSGIDQP.VGANVS
   68-   88 (27.16/16.18)	TLGQPgTTSRGDQShRGAQVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.40|      36|     230|     120|     161|      11
---------------------------------------------------------------------------
  121-  161 (63.14/62.83)	WLVNWDQRPHgvDEADTVQTsriGRPVHEW...............MHL...CLDVIWIL
  452-  505 (54.25/34.01)	WSFNTSIREH..LNSDQLQK...GKQIDEWwkqmtkasgermidfMNLderAMGMFWVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.46|      13|      23|     188|     200|      13
---------------------------------------------------------------------------
  188-  200 (23.57/13.55)	DDAVICIIMEIHR
  213-  225 (26.90/16.41)	DQHLHCPTFGTHR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP24363 with Med23 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) AVPNAPSFHASNPTSPLSAMNTIGSPTQSGIDQPVGAN
20
57

Molecular Recognition Features

MoRF SequenceStartStop
NANANA