<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24353
Description |
Uncharacterized protein |
Sequence | MIFFFVITSVRGLSVTLYMCCLILSQARVLREFSPEEVTANIYTMVDVLLHHIQLELQRGHLVQDLLSKAITNLAFFVWTHELVPLDIVLLALIDRDDDPYALRLVISLLERPELQHRIKAFCSSRSPEHWLKNQPPKRAELQKALGNHLSWKD |
Length | 154 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.175 |
Instability index | 48.83 |
Isoelectric point | 6.65 |
Molecular weight | 17870.76 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24353
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.86| 12| 14| 86| 98| 2
---------------------------------------------------------------------------
86- 98 (14.72/13.58) LDIVlLALIDRDD
103- 114 (19.14/12.12) LRLV.ISLLERPE
---------------------------------------------------------------------------
|