<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24329
Description |
Uncharacterized protein |
Sequence | TVRHPNIMMFIGACQEASGSGLVYEFLPNRSLEEHLSCKEKKNTPPLTWQVRTRIIGEIWSALTFIHSHKPLPIVHGDLKPDNILLDANFVSKLRICQVSKNPRATKNTKDPKFLTTGELTPQCDVYSFGIVILRLLTGRSSQKIVVTVEKAMEKGHLHSIIDDSAGSWPYQQAGQLARLGLRCTNLSGKLQPDLIGGVWGELEPLMKAASRNAGRPSFAASSMTHTHHPALSTFGVMHGEQEVMHDPQIAADGFTYEAEAIRTWLDSGHDTSPMTNLKLKHCDLTPNRALHSAILEWQQQQKKHGT |
Length | 307 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.352 |
Instability index | 34.11 |
Isoelectric point | 8.69 |
Molecular weight | 34104.70 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
ubiquitin-protein transferase activity GO:0004842 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24329
No repeats found
|