| Description | Uncharacterized protein |
| Sequence | MEELGNSQGPRAEAVAAHCREFMLYMKEIQTTMREEIKSACEYRPFEKCDYSARIANEICCKKLEYVIEKMDAMQLNMEQSSNGV |
| Length | 85 |
| Position | Head |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.571 |
| Instability index | 52.04 |
| Isoelectric point | 5.00 |
| Molecular weight | 9851.24 |
| Publications | PubMed=25035499 PubMed=29158546 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP24317 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ACEYRPFEKCDY 2) KMDAMQL 3) QGPRAEAVA 4) RIANE | 40 70 8 54 | 51 76 16 58 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab