<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24260
Description |
Mediator of RNA polymerase II transcription subunit 13 |
Sequence | AEWQKAIYSFGGNEVKKWPVQLRRSIPDGIPSNSNGPTLEQQDMGLIQDRNMPSSPSTLYSPHPKSSFTKGQPGNKKQILAEQTGIEGSRGSLHLVRSISLVAVSQDSSLHLACQADLLATRPTSGEGNQSSSTGASSYLDGFAPVKSIGSMSASYLLVPSPSMRYLSPATLQLPTCLTSESPPLAHLLHSKGTATPLAMGYVVSKAVPPVRKQPTKEDSRHSVLSVSIVDYYGGTVQDKMSRGSKQAARHETSARDYVTDMHNVLEAVAAELHALSWMTVSPVYMERRSALPFHCDMVLRLRRLLHYADRHLSQPTDKGDVS |
Length | 323 |
Position | Kinase |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.393 |
Instability index | 70.72 |
Isoelectric point | 9.15 |
Molecular weight | 35079.34 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364134
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24260
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.93| 12| 15| 92| 103| 1
---------------------------------------------------------------------------
92- 103 (19.65/10.18) SLHLVRSISLVA
109- 120 (21.28/11.46) SLHLACQADLLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.22| 33| 111| 28| 62| 2
---------------------------------------------------------------------------
28- 62 (52.59/35.84) DGI.PSNSNGpTLEQQDMgLIQDRNMPS.SPSTLYSP
141- 175 (51.63/26.51) DGFaPVKSIG.SMSASYL.LVPSPSMRYlSPATLQLP
---------------------------------------------------------------------------
|