<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24244
| Description |
Uncharacterized protein |
| Sequence | QDVLGQFSMVSMELFNIVEDIKKVNKGFVVYPRNVNAENAAILPVMLSSKLLPEMEVEETTKREQLLSGITNLPVPSQMEKLKARIDMIANACETAERVIAECRKTHGLGARQGANLGPMLDKAQAAKIQEQESLLRAAVNYGEGLRVSGDQRQMHSSLPSHLMEVLATGDGAHNFGDNSGAYPKNTPAFSPNNVNAQGNPMQASGGQLLGRSAPSPGTAGTPNFENVSTPPMPYANSPRSGTNMMNTPSP |
| Length | 251 |
| Position | Head |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.420 |
| Instability index | 46.57 |
| Isoelectric point | 6.14 |
| Molecular weight | 26873.17 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24244
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.82| 23| 26| 128| 152| 1
---------------------------------------------------------------------------
130- 152 (38.78/27.55) QEQESL...LRAAVNYGEGLRVSGDQ
154- 179 (36.04/18.86) QMHSSLpshLMEVLATGDGAHNFGDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.69| 22| 32| 196| 217| 3
---------------------------------------------------------------------------
196- 217 (40.29/22.22) NAQGNPMQASGGQLLGR...SAPSP
227- 251 (37.41/20.14) NVSTPPMPYANSPRSGTnmmNTPSP
---------------------------------------------------------------------------
|