<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24242
| Description |
Uncharacterized protein |
| Sequence | MHSSLPSHLMEVLATGDGAHNFGDNSGAYPKNTPAFSPNNVNAQGNPMQASGGQLLGRSAPSPGTAGTPNFENVSTPPMPYANSPRSGTNMMNTPS |
| Length | 96 |
| Position | Head |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.664 |
| Instability index | 49.60 |
| Isoelectric point | 6.22 |
| Molecular weight | 9812.64 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24242
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.94| 19| 29| 30| 48| 1
---------------------------------------------------------------------------
30- 48 (37.74/15.00) PKNTPAFSPNNVNAQGNPM
61- 79 (36.20/14.14) PSPGTAGTPNFENVSTPPM
---------------------------------------------------------------------------
|