<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24236
| Description |
Uncharacterized protein |
| Sequence | QQFGLTGGHPQRSHQMMTDQMYGMGGANTTSMMGMQMQQQQQQQQQGLYGNMQGGGQSLQQQGMVGLQNQQQNQMQGGGQSLQQQGMVGLQNQQQNQMQNQMQNQMQNQLQNQMPNPNFSQQRQQNQQ |
| Length | 128 |
| Position | Head |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.445 |
| Instability index | 61.01 |
| Isoelectric point | 8.60 |
| Molecular weight | 14477.81 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24236
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 129.40| 21| 21| 52| 72| 1
---------------------------------------------------------------------------
21- 40 (36.56/ 8.55) MYGMGGA.NTTSMMGMQMQQQ
52- 72 (46.42/13.70) MQGGGQSLQQQGMVGLQNQQQ
75- 95 (46.42/13.70) MQGGGQSLQQQGMVGLQNQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.70| 14| 15| 96| 109| 2
---------------------------------------------------------------------------
96- 109 (27.70/ 7.02) NQMQNQMQNQMQNQ
112- 125 (28.00/ 7.18) NQMPNPNFSQQRQQ
---------------------------------------------------------------------------
|