<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24234
| Description |
Uncharacterized protein |
| Sequence | PPAPAPAMDAAAAPGAAAGGQQQQQPAPPRAERLNGEVQSQLNLEGMRARAVGLYKAISRILEDFDAIARVNPSGSPKWQDVLGQFSMVSMELFNIVEDIKKVNKGFVVYPRNVNAENATVLPVMLSSKLLPEMEVEETTKREQLLSGITNLPVPSQMEKLKARIDMIANACETAERVIAECRKTHGLGARQGANLGPMLDKAQAAKIQEQESLLRAAVNYGEGLRVSGDQRQMHSSLPSHLMEVLATGDGAHNFGDNSGAYPKNTPAFSPNNVNAQGNPMHLEDNYLADLLHRLELPEPLILKMCLLLQCHMLTPLGQAPI |
| Length | 322 |
| Position | Head |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.285 |
| Instability index | 50.61 |
| Isoelectric point | 5.86 |
| Molecular weight | 34860.60 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24234
No repeats found
|