<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24227
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDNAAPNSSSSAAATAAAVAAAAASGNGVQGGDRPEDPSKQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPEDIEAYRQIRATSAAPSGSVSLSW |
| Length | 179 |
| Position | Middle |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.247 |
| Instability index | 36.04 |
| Isoelectric point | 4.90 |
| Molecular weight | 18946.98 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24227
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.59| 13| 18| 49| 64| 1
---------------------------------------------------------------------------
49- 61 (22.61/18.86) SIQRTLGLLHQLN
68- 80 (21.98/ 9.07) SSASQLPLLQRLN
---------------------------------------------------------------------------
|