| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | KQKNCCFSKKKQKNFTNRTVEAFRSPVFSPSDFAMDNAAPNSSSSAAATAAAVAAAAASGNGVQGGDRPEDPSKQNLAQVTASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFK |
| Length | 174 |
| Position | Middle |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.357 |
| Instability index | 34.03 |
| Isoelectric point | 8.73 |
| Molecular weight | 18528.67 |
| Publications | PubMed=25035499 PubMed=29158546 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP24225
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.59| 13| 16| 83| 98| 1
---------------------------------------------------------------------------
83- 95 (22.61/19.03) SIQRTLGLLHQLN
102- 114 (21.98/ 9.32) SSASQLPLLQRLN
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FAMDNA 2) KQKNCCFSKKKQKNFTNRTVEAFRSPVFSP | 33 1 | 38 30 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab