<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24209
Description |
Uncharacterized protein |
Sequence | TSRIKLVFVYSCPNAESFYRKSMSEYDPRLVAPACLYLASKVEESTVQARLLVFYIKKMCGSDDKYRFEIKDILEMEMKLLEALDYYLVVYHPYRPLLHLLQDAGVTDLTQFAWGLVNDTYKMDLILVQPPYMIALACIYIASVLKDKDTTSWFEELHVDMNIVKNISMEILDFYETYKVDPQRGLSDEKISPIMNKLPAKA |
Length | 202 |
Position | Kinase |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.024 |
Instability index | 47.13 |
Isoelectric point | 5.28 |
Molecular weight | 23484.17 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24209
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.73| 10| 35| 18| 27| 1
---------------------------------------------------------------------------
18- 27 (19.96/14.11) FYRKSMSEYD
54- 63 (20.77/14.95) FYIKKMCGSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.52| 13| 100| 28| 40| 2
---------------------------------------------------------------------------
28- 40 (25.43/13.98) PRLVAPACLYLAS
131- 143 (26.09/14.47) PYMIALACIYIAS
---------------------------------------------------------------------------
|