<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24166
| Description |
Uncharacterized protein |
| Sequence | IHNMTLSISGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMKLGQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKDKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKVIYNYYLLPGTTNFLAAHFVGLLT |
| Length | 212 |
| Position | Head |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.171 |
| Instability index | 32.67 |
| Isoelectric point | 9.60 |
| Molecular weight | 24476.65 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24166
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.48| 18| 18| 128| 145| 1
---------------------------------------------------------------------------
116- 135 (28.16/ 8.70) KPKSESKDKEkkHK.KHKDKD
136- 155 (25.85/ 7.53) KDREHKKHKH.rHKdRSKDKD
156- 172 (31.47/10.38) KDKDKKKDKH..HE.K.KRKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 28.28| 9| 22| 65| 76| 2
---------------------------------------------------------------------------
65- 76 (11.31/16.17) LGQLVQnayLRD
89- 97 (16.97/10.84) LGQAFQ...LRE
---------------------------------------------------------------------------
|