Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | ASGNGVQGVAGGDRPEDPSKQNLAQVTGSIQKTLGLLHQLNLNVSSFSSASQLPLLQRLNALVAELDTMQKLADGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQITKGKTDAFKSLRKHLLEELEEAFPDDAEAYRQIRATSAAGSKRLAQSQSALPNGDAKVKPEH |
Length | 173 |
Position | Middle |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.478 |
Instability index | 31.98 |
Isoelectric point | 5.63 |
Molecular weight | 18588.66 |
Publications | PubMed=25035499 PubMed=29158546 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24111 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.31| 13| 16| 29| 44| 1 --------------------------------------------------------------------------- 29- 41 (22.36/15.10) SIQKTLGLLHQLN 48- 60 (21.95/ 7.22) SSASQLPLLQRLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EAYRQIRAT 2) RKHLL 3) RLAQS | 139 123 154 | 147 127 158 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab