Description | Uncharacterized protein |
Sequence | MDHHHPPPLPQQHGDHYRPLVLSPQPDHAHALQYQQPQQQQQQQATPPPQHHHPSLASHFHLLHLVTRLGDAIATGTRDQAFDALVEELTSQFARSQQLLNSISGTLSSKSVTVEGQMQSLEETRQLLDQRKDLIAKYKSSVEDLLKGDPTR |
Length | 152 |
Position | Middle |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.842 |
Instability index | 54.91 |
Isoelectric point | 6.33 |
Molecular weight | 17141.86 |
Publications | PubMed=25035499 PubMed=29158546 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP24090 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.55| 22| 22| 9| 30| 1 --------------------------------------------------------------------------- 2- 26 (39.31/14.93) DHHHpppLPQQHGDHYRPLVLSPQP 27- 49 (38.24/14.34) DHAH..aLQYQQPQQQQQQQATPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.60| 16| 27| 86| 101| 2 --------------------------------------------------------------------------- 86- 101 (25.43/12.88) VEELTSQFARSQQLLN 114- 129 (26.16/13.40) VEGQMQSLEETRQLLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DHYRPLVLS 2) LIAKYK 3) VEDLLK | 15 134 142 | 23 139 147 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab