<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24003
| Description |
Uncharacterized protein |
| Sequence | MQFLEDFVNCNEVASFLDCIRLTAGPLLSLGGAIRPAKMPAVPAVCGSAQKQNNVLLANGSSSTTVHINSHDAQTSSMLSAVGWTGHGLVPSSLMPFDVSVVLRGPYWIRIIYRNKFSVDMRCFAGDQVWLQPATPPKGGPSIGGSLPCPQFRPFIMEHVAQGLNTLEPSFLNARHTSANTSSGSQQVDTTMNRLSGGTPGEIKLTSGVGCQIAASVSRAGNATLPSGDGAPAHLSPDTNLPVHMKGELNTAFIGLGDDGGYGGGWVPHAALKKVLRGILKYLGVLWLFAQLRDILKDILGSVLKDNEGALLNLDQEQPALRFFVG |
| Length | 326 |
| Position | Tail |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.041 |
| Instability index | 37.82 |
| Isoelectric point | 7.67 |
| Molecular weight | 34486.11 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24003
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.07| 26| 28| 228| 255| 1
---------------------------------------------------------------------------
228- 255 (43.71/26.14) GD..GAPAHLSPDTNLPVHMKGELNtaFIG
257- 284 (43.35/20.99) GDdgGYGGGWVPHAALKKVLRGILK..YLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.39| 14| 23| 181| 194| 4
---------------------------------------------------------------------------
181- 194 (23.92/18.63) TSSGSQQVDTTMNR
206- 219 (23.47/18.14) TSGVGCQIAASVSR
---------------------------------------------------------------------------
|