<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23994
Description |
Mediator of RNA polymerase II transcription subunit 14 |
Sequence | MAGELGQQTVELGTVARQAAEESYLALRELVEKSRAGAEGEVAQQRSDTEKKIDLLKFIDRTRQRMLRLHVLAKWCQQVPLLHYCQQLASTLSSHETCFIQTGDSLFFMHEGLQQARAPIFDVSSAIEVIHTGSYRRLPKSVEEIGTQNTLFQDERKPTLKKLSTLVRAKLLETLVPKEMSEVSVTDGIANVQVDGEFKVLLTLGYRGHFSLWRILHIELLVGENTGPIKLEETRRYVLGDDIERRMAVADNPLTILYTILHELCISFVMDTVIRQTNVLRQGRWKEAIKSELVSDSHRSAGQGGNNAPTQLGQDGELDSSGFRIPGLKINYWLDERNSGSAESDSSPFIKVEALQDMQIKCQHSSFVLDPLTDKEADLSLDLSCIDVEAIILKAIACNRHTRLLEIQRELKKNTRISRSPTDVVLKRKEVHMDVLQKRVDRRGFENCCTNEVLQVRAYGKSYIHLGINIRSGGFLLQSPKNILPPSAVLDSEEALNKRSITPTEVFVSLKTRSILQLFAATGRFLGVKVYSECQITLKIPKSILYGSDFMVMGFPWRTNAYYLLMQLDDNLMPVFYLLEVHIDGEDRSNIDTTTDAKEVVRFNRIDIGQMQLGEDECIANLLDVEKLQVLQSMEDGSPGHSEIDESLPLKPSFSSVVNAVLGYERDSPSKENWLSYSSPSTHLSSQKVGRQGVSSRAGPPELDDELLHSNIDTAKVASGVTLDSYLLSNSKSANSTETSVSVPAGDHPSKLSAC |
Length | 755 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.283 |
Instability index | 51.13 |
Isoelectric point | 5.74 |
Molecular weight | 84337.03 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23994
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.72| 11| 250| 335| 362| 4
---------------------------------------------------------------------------
317- 327 (21.22/15.88) ELDSSGF.........RIPG
343- 362 (14.51/17.08) ESDSSPFikvealqdmQIKC
---------------------------------------------------------------------------
|