<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23991
Description |
Uncharacterized protein |
Sequence | SGYVFAVSVQRVQLHLQVLNVKRFHHQQQQQQAPQSSAQGELTPSEIHEICDYFSRCVVCEPYDASRIASFIMLLTLPISVIQEFVKLITWNKSLSEAHGDIAAAERARAELCLEKHPRSVSDDYTEPSLLSKSNIQHDRANNSVDFTLTFVLDHNLTPHVRTSGGAAWLPFCVSLRLRYTFGDTSHIAYLAMDGSHGGRSCWLQHEDWERCKQSVVKAVKMVNGSPAGGETSRGRLQMVAEMVQKQLQLCLVHLRDGSLSAGSTRP |
Length | 267 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.257 |
Instability index | 54.98 |
Isoelectric point | 7.19 |
Molecular weight | 29828.52 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23991
No repeats found
|