<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23988
| Description |
Uncharacterized protein |
| Sequence | AAEPQAQEQQQQQLLPEGAASVPSLCSSDRAEAITDDGAPRHDDDSVAAEAEKIKAVLVNYQEKSEAALLDLLRRLQQLEFTVHTLKVTAIGKTVGTLRKHNSKQIRHLVRLLIGGWKSIVDEWMSNGGSGDAIVDHTPQSMHPSSLEQEDRGMSSPSVDEGALFATPSTSIRLSEDNQGSRMFDGMDDAGNTRNSVQRHPGSQEPIRRPPQPVAQQYDPDQSWRQEQSAARQSRPQELANGQTREQFIAAMLTKPSSAESGRGRPQVRPKQQQGASPAQGRPQPVPSDVSILHFEQNLCACLTCTNPKLCVRPAETGGQS |
| Length | 321 |
| Position | Unknown |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.770 |
| Instability index | 68.80 |
| Isoelectric point | 5.80 |
| Molecular weight | 34989.41 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23988
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.77| 21| 261| 4| 24| 2
---------------------------------------------------------------------------
4- 24 (38.54/21.41) PQAQEQQQQQLLP.EG.AASVPS
266- 288 (33.23/17.36) PQVRPKQQQGASPaQGrPQPVPS
---------------------------------------------------------------------------
|