<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23977
Description |
Uncharacterized protein |
Sequence | VPPMLPLPMAALVSLTITFKLDRSLDYIHGIIGQALENCAGGSSWPSMPIIGALWTQKVRRWHDFIVLSCIRSPFGRDKDAVAQLIQSCFSSFLRSSPSSGSDITASRGVGALMGESITGHQGLHFPMAPGFIYLRTCRTFHDTYFVSEMILRQVIDCSHKLANGWSSNGPPHLKSGRPPLSGAASMASQVAMLGAGLLCVAGGPLLVQVLYEETLPTLLLSAQEQMLEDPGPVASTLQGYAMANMLFFCGSLLWGSEKTSPIMKLSFLSRRPRVVGTHMDFIAGVLDGHILLGCDPGTWKAYVSCFVFLVVKFVPTWLRDIKLDTLKKIAVGLRSWHEHDLALSLLERGGPKTISAVVETLLQ |
Length | 364 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.275 |
Instability index | 47.49 |
Isoelectric point | 8.57 |
Molecular weight | 39551.84 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23977
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.50| 30| 215| 66| 104| 1
---------------------------------------------------------------------------
66- 104 (37.59/48.42) IVLSCirSPfGRDKDAVaqliqSCFsSFL..RSSPSSGSDI
291- 322 (56.91/36.17) ILLGC..DP.GTWKAYV.....SCF.VFLvvKFVPTWLRDI
---------------------------------------------------------------------------
|