<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23975
Description |
Uncharacterized protein |
Sequence | KSIDAALQLSKSYGVSGTDFGHVVILFVLIVITKLIDSVLEDCGISSGMTQDQESVYPIEGPQPMDMDVKGVSAVKQNEQREQLRRRNIVMALEVLHIMAADTKIQAFLRLICLNMYVLNKLINMSTL |
Length | 128 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.05 |
Grand average of hydropathy | 0.244 |
Instability index | 54.78 |
Isoelectric point | 5.61 |
Molecular weight | 14225.56 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23975
No repeats found
No repeats found
|