<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23966

Description Uncharacterized protein
SequenceHWIEAETPDFRARMRRIYLPTKLATYFQPKYSPNSLEAQTLIARLEEDAFRGTNSKVEYVKKISDKVVTMLRNKTDELQRRAQLQSQLQQAIEAQALHGGSSSVMPEAVMVASRRPTSQSMAPQTSGLVPNQNMLHPCTSNMQIEVEKKHHGQDHYPNFQPMGITRAGPGVQSGAWPMQSGASQSESQYMARQPQATNFVGYSLASGSKPVIRPNSQHNHPLGQNDSAIGVRQPQITRLNEILRANQQEMGTQRYQMLGAQQADVSKMQPGQLRIRNNQEDARQTGFLHPPFKVSEPMTPPVQQIPGAQQSQIPAMMGSTREYDLEEIFCKIKSWKDAYFPQFLELDRRVVLPTLTEEQFSSLPEAKANLYIRKADFKKSIRRILNLMSLQKSDVHDGLKVDLPKYEKLIHHFLALLERNKTCHAKMNTGYQLQNCDEQRKAINLTGNASPITGGTSREQKQPADARILQPRQTTMARTTTPHQQSNDNYLQGIESASFSSPGSLQSSLQSWSSSMLESLRPSPLANPVVAPASPCAPVPIISMDVDSITAFLMDDNAAAAPPPKANGSNQVTRTEPIVPASPLQADIAAGHGEVQARGGDGTPVTKRPIDRLMDAIRSSSPGALHSSINSIRSFLSMSDIVPHGKIGTMLDCNSLQQQGGCNTVNKMKRVFNHTGSRSQSLPLGSMDGSCMSFECGASDSGSSSEVNFKRQKIQNASNEALLEEIKSINSTLIDTVLSISDYCGMDGIPRCDGGTTIKLSYSAVSLSPTFKSVFATSEA
Length780
PositionTail
OrganismAegilops tauschii subsp. strangulata (Goatgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
Aromaticity0.05
Grand average of hydropathy-0.539
Instability index62.13
Isoelectric point8.92
Molecular weight85691.96
Publications
PubMed=25035499
PubMed=29158546

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23966
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     121.74|      33|      38|     217|     250|       1
---------------------------------------------------------------------------
  184-  215 (21.20/ 7.11)	.......QSESQYMARQPQATNFvgyslasgsKPVIRP.N...
  217-  249 (58.54/33.73)	QHNHPLGQNDSAIGVRQPQITRL.........NEILRA.NQQE
  253-  280 (41.99/18.28)	QRYQMLGAQQADVSKMQP...............GQLRIrNNQE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.59|      28|      37|     505|     540|       2
---------------------------------------------------------------------------
  494-  521 (43.89/18.18)	IESASFSSPGSLQS.SLQSWSSSM.LE...SLR
  530-  561 (35.28/28.57)	VAPASPCAPVPIISmDVDSITAFL.MDdnaAAA
  620-  642 (26.41/ 8.65)	......SSPGALHS.SINSIRSFLsMS...DIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.40|      31|      37|      80|     115|       3
---------------------------------------------------------------------------
   38-   73 (44.10/27.70)	AQ...TLIARLEEDAFRGTNSKVeyvkkISDKVVTMLRN
   82-  115 (46.29/36.45)	AQlqsQLQQAIEAQALHGGSSSV.....MPEAVMVASRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.95|      26|      40|     643|     670|       5
---------------------------------------------------------------------------
  643-  670 (42.31/37.43)	PHGKI.GTML..DCNSlQQQGGCNTVNkMKR
  683-  711 (39.64/25.30)	PLGSMdGSCMsfECGA.SDSGSSSEVN.FKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     114.01|      30|      31|     326|     355|       6
---------------------------------------------------------------------------
    2-   23 (27.17/14.70)	.........WIE......AETPDFRARMRRIY.LPTkL
  326-  355 (54.89/36.79)	EEIFCKIKSWKD......AYFPQFLELDRRVV.LPT.L
  357-  390 (31.96/18.52)	EEQFSSLPEAKAnlyirkADFKKSI...RRILnLMS.L
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     169.61|      59|     272|     124|     183|       7
---------------------------------------------------------------------------
  124-  156 (44.01/20.02)	..........................QTSGLVPNQNMLHPCTSNMQIEVEKKHHGQDHY
  158-  183 (31.15/13.87)	NFQPMGITRAGPGVQSGAWPMQSGAS.................................
  432-  490 (94.45/49.12)	QLQNCDEQRKAINLTGNASPITGGTSREQKQPADARILQPRQTTMARTTTPHQQSNDNY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23966 with Med15 domain of Kingdom Viridiplantae
Unable to open file!