<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23965

Description Uncharacterized protein
SequenceWIEAETPDFRARMRRIYLPTKLATYFQPKYSPNSLEAQTLIARLEEDAFRGTNSKVEYVKKISDKVVTMLRNKTDELQRRAQLQSQLQQAIEAQALHGGSSSVMPEAVMVASRRPTSQSMAPQTSGLVPNQNMLHPCTSNMQIEVEKKHHGQDHYPNFQPMGITRAGPGVQSGAWPMQSGASQSESQYMARQPQATNFVGYSLASGSKPVIRPNSQHNHPLGQNDSAIGVRQPQITRLNEILRANQQEMGTQRYQMLGAQQADVSKMQPGQLRIRNNQEDARQTGFLHPPFKVSEPMTPPVQQIPGAQQSQIPAMMGSTREYDLEEIFCKIKSWKDAYFPQFLELDRRVVLPTLTEEQFSSLPEAKANLYIRKADFKKSIRRILNLMSLQKSDVHDGLKVDLPKYEKLIHHFLALLERNKTCHAKMNTGYQLQNCDEQRKAINLTGNASPITGGTSREQKQPADARILQPRQTTMARTTTPHQQSNDNYLQGIESASFSSPGSLQSSLQSWSSSMLESLRPSPLANPVVAPASPCAPVPIISMDVDSITAFLMDDNAAAAPPPKANGSNQVTRTEPIVPASPLQADIAAGHGEVQARGGDGTPVTKRPIDRLMDAIRSSSPGALHSSINSIRSFLSMSDIVPHGKIGTMLDCNSLQQQGGCNTVNKMKRVFNHTGSRSQSLPLGSMDGSCMSFECGASDSGSSSEVNFKRQKIQNASNEALLEEIKSINSTLIDTVLSISDYCGMDGIPRCDGGTTIKLSYSAVSLSPTFKSVFATSEAVLWISEFRHLLHVTLQCTDCFSD
Length802
PositionTail
OrganismAegilops tauschii subsp. strangulata (Goatgrass)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
Aromaticity0.05
Grand average of hydropathy-0.508
Instability index62.12
Isoelectric point8.72
Molecular weight88299.96
Publications
PubMed=25035499
PubMed=29158546

Function

Annotated function
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP23965
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     121.74|      33|      38|     216|     249|       1
---------------------------------------------------------------------------
  183-  214 (21.20/ 8.18)	.......QSESQYMARQPQATNFvgyslasgsKPVIRP.N...
  216-  248 (58.54/38.39)	QHNHPLGQNDSAIGVRQPQITRL.........NEILRA.NQQE
  252-  279 (41.99/20.86)	QRYQMLGAQQADVSKMQP...............GQLRIrNNQE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.59|      28|      37|     504|     539|       2
---------------------------------------------------------------------------
  493-  520 (43.89/19.88)	IESASFSSPGSLQS.SLQSWSSSM.LE...SLR
  529-  560 (35.28/31.16)	VAPASPCAPVPIISmDVDSITAFL.MDdnaAAA
  619-  641 (26.41/ 9.55)	......SSPGALHS.SINSIRSFLsMS...DIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      90.40|      31|      37|      79|     114|       3
---------------------------------------------------------------------------
   37-   72 (44.10/24.96)	AQ...TLIARLEEDAFRGTNSKVeyvkkISDKVVTMLRN
   81-  114 (46.29/32.83)	AQlqsQLQQAIEAQALHGGSSSV.....MPEAVMVASRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.95|      26|      40|     642|     669|       5
---------------------------------------------------------------------------
  642-  669 (42.31/33.85)	PHGKI.GTML..DCNSlQQQGGCNTVNkMKR
  682-  710 (39.64/22.78)	PLGSMdGSCMsfECGA.SDSGSSSEVN.FKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     114.01|      30|      31|     325|     354|       6
---------------------------------------------------------------------------
    1-   22 (27.17/14.04)	.........WIE......AETPDFRARMRRIY.LPTkL
  325-  354 (54.89/35.16)	EEIFCKIKSWKD......AYFPQFLELDRRVV.LPT.L
  356-  389 (31.96/17.69)	EEQFSSLPEAKAnlyirkADFKKSI...RRILnLMS.L
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.15|      25|      42|     717|     742|       7
---------------------------------------------------------------------------
  717-  742 (35.83/36.84)	SNEALLEEIKSINSTlIDTVLSISDY
  762-  786 (42.31/37.44)	SAVSLSPTFKSVFAT.SEAVLWISEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     169.61|      59|     272|     123|     182|       8
---------------------------------------------------------------------------
  123-  155 (44.01/23.38)	..........................QTSGLVPNQNMLHPCTSNMQIEVEKKHHGQDHY
  157-  182 (31.15/16.26)	NFQPMGITRAGPGVQSGAWPMQSGAS.................................
  431-  489 (94.45/57.02)	QLQNCDEQRKAINLTGNASPITGGTSREQKQPADARILQPRQTTMARTTTPHQQSNDNY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP23965 with Med15 domain of Kingdom Viridiplantae

Unable to open file!