<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23942
| Description |
Uncharacterized protein |
| Sequence | MSQQQARQPNASTSVQASSLTNIRQNLPGVNQTSTMQTASVIPQNTMNNDLAQGTSQDGYAAQRQMAGRQQQQQSQQLIYHQHQQPSLQSQQPNIPLQQQQQQLMGQQPNLQQNQLIGQQNGAVMMQQQQRLAVQSNNLLNVQQTHQMLNQQYIPLYQPQQLG |
| Length | 163 |
| Position | Tail |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -1.038 |
| Instability index | 77.30 |
| Isoelectric point | 9.98 |
| Molecular weight | 18383.14 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23942
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.80| 19| 43| 99| 118| 2
---------------------------------------------------------------------------
99- 118 (32.62/11.77) QQQQQLMGQQ..PnLQQNQLIG
143- 163 (29.19/ 6.73) QQTHQMLNQQyiP.LYQPQQLG
---------------------------------------------------------------------------
|