<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23929
| Description |
Uncharacterized protein |
| Sequence | VSRDWKILVDEWVSTTNVALADNSPGTSNPSVVDDDEEEEGLPSPPLDEGAFFAPETTAIQLSEFFDEMDEDGNLRHNNDVRLGNKRENNGRRPANHSTVSKPELTRPVGTVERDQFRRPELTRQEPPMRHTNQQKPQGSNLQAKPHGMLNKQSRPLSSDSGSMRPMKAATQQKPIGEMKYKQTQEHFGVERKPAMGHVDKSRLRAQPSSGVRLESARPKTQDGLESNVRLEAAKRRLQERYQEAENAKKQRTIQVMELGDIPKPKSNTRQPMVKSRNNIRSRVLGRR |
| Length | 288 |
| Position | Unknown |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.198 |
| Instability index | 58.42 |
| Isoelectric point | 9.69 |
| Molecular weight | 32656.09 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23929
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 153.58| 35| 35| 103| 137| 1
---------------------------------------------------------------------------
43- 100 (24.83/ 8.16) ......PSPPLDEGAFFAPETTaiqlseffdemdedgnlrhnndvrlgnkRENN...GRRPANHSTV
103- 137 (62.81/30.20) PEL.TRPVGTVERDQFRRPELT............................RQEP...PMRHTNQQKP
140- 175 (42.04/18.15) SNLqAKPHGMLNKQS..RP.LS............................SDSGsmrPMKAATQQKP
177- 201 (23.91/ 7.63) ........GEMKYKQTQEHFGV............................ERKP...AMGHVDK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.38| 14| 14| 210| 223| 2
---------------------------------------------------------------------------
210- 223 (24.88/14.75) SGVRLESARPKTQD
227- 240 (23.50/13.60) SNVRLEAAKRRLQE
---------------------------------------------------------------------------
|