<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23922
| Description |
Uncharacterized protein |
| Sequence | MAHPANKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPAPAPAPAPVPTPPPVPAPPSSLPTMSAVGASAMPPMQFIGTPGANNPKNEMRNVMGGRKRKMG |
| Length | 102 |
| Position | Middle |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.760 |
| Instability index | 82.25 |
| Isoelectric point | 11.37 |
| Molecular weight | 11091.83 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23922
No repeats found
|