<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23914
Description |
Uncharacterized protein |
Sequence | MGDGRGGGSNRPAWLQQYELVGKIGEGTYGLVFLARLKPTHPQAAGRRGSPIAIKKFKQSKEGDGVSPTAIREIMLLREINHENVVKLVNVHINHADMSLYLAFDYAEHDLYEVIRHHREKLNLSINQYTVKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGEGEEHGIIKIADFGLARIYQAPLKPLSDNGVVVTIWYRAPELLLGAKHYTSAVDMWAVGCIFAELLTLKPLFQGVEAKATPNPFQLDQLDKIFKVLGMYSLFLLVLFDLSCSSEIYSQQ |
Length | 283 |
Position | Kinase |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.055 |
Instability index | 28.12 |
Isoelectric point | 7.81 |
Molecular weight | 31892.56 |
Publications | PubMed=25035499
PubMed=29158546
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23914
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.12| 18| 147| 22| 39| 1
---------------------------------------------------------------------------
22- 39 (33.29/20.09) GKIGEGTYGL..VFLARLKP
170- 189 (28.83/16.59) GIIKIADFGLarIYQAPLKP
---------------------------------------------------------------------------
|