Description | Uncharacterized protein |
Sequence | MDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDAALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSASAPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGPSAAGPGGGVSTPAAGAGGQHVHGGVESRFPEDGTQ |
Length | 162 |
Position | Tail |
Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.115 |
Instability index | 56.21 |
Isoelectric point | 4.95 |
Molecular weight | 16573.24 |
Publications | PubMed=25035499 PubMed=29158546 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
Binary Interactions |
Repeats | >MDP23875 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.57| 17| 19| 7| 25| 1 --------------------------------------------------------------------------- 1- 22 (17.28/14.98) MDAtvdELSAAYKefVAAAVAV 23- 40 (25.29/14.36) MEA..rEQSGGQK..TAATDAA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.33| 18| 44| 80| 97| 2 --------------------------------------------------------------------------- 80- 97 (29.82/12.48) GSSSSASAPASVALAAPG 125- 142 (33.50/14.78) GGPSAAGPGGGVSTPAAG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGAGG 2) HVHGGVESRFPED | 141 147 | 145 159 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab