| Description | Uncharacterized protein |
| Sequence | MDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDAALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSASAPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGPSAAGPGGGVSTPAAGAGGQHVHGGVESRFPEDGTQ |
| Length | 162 |
| Position | Tail |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Pooideae> Triticodae> Triticeae> Triticinae> Aegilops. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.115 |
| Instability index | 56.21 |
| Isoelectric point | 4.95 |
| Molecular weight | 16573.24 |
| Publications | PubMed=25035499 PubMed=29158546 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP23875
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.57| 17| 19| 7| 25| 1
---------------------------------------------------------------------------
1- 22 (17.28/14.98) MDAtvdELSAAYKefVAAAVAV
23- 40 (25.29/14.36) MEA..rEQSGGQK..TAATDAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.33| 18| 44| 80| 97| 2
---------------------------------------------------------------------------
80- 97 (29.82/12.48) GSSSSASAPASVALAAPG
125- 142 (33.50/14.78) GGPSAAGPGGGVSTPAAG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AGAGG 2) HVHGGVESRFPED | 141 147 | 145 159 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab