<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23873
| Description |
Uncharacterized protein |
| Sequence | LCVPGYLRVPRAQIGGFSGYSVSGACRMMRKKRSGGGMDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDAALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSASAPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGPSAAGPGGGVSTPAAGAGGQHVHGGVESRFPEDGTQ |
| Length | 199 |
| Position | Tail |
| Organism | Aegilops tauschii subsp. strangulata (Goatgrass) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Triticinae> Aegilops.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.125 |
| Instability index | 55.88 |
| Isoelectric point | 6.49 |
| Molecular weight | 20458.81 |
| Publications | PubMed=25035499
PubMed=29158546
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23873
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.57| 17| 19| 44| 62| 1
---------------------------------------------------------------------------
38- 59 (17.28/16.43) MDAtvdELSAAYKefVAAAVAV
60- 77 (25.29/15.74) MEA..rEQSGGQK..TAATDAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.33| 18| 44| 117| 134| 2
---------------------------------------------------------------------------
117- 134 (29.82/12.44) GSSSSASAPASVALAAPG
162- 179 (33.50/14.81) GGPSAAGPGGGVSTPAAG
---------------------------------------------------------------------------
|