<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23868
Description |
Mediator complex subunit 28 |
Sequence | MAAPLGGMFSGQPPGHPGDSRGQASLLQAAPGPPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPQTSLRPWPTSSRPLLISPHQ |
Length | 170 |
Position | Head |
Organism | Ursus americanus (American black bear) (Euarctos americanus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.625 |
Instability index | 58.33 |
Isoelectric point | 6.51 |
Molecular weight | 19107.38 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP23868
No repeats found
No repeats found
|