<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23862
| Description |
Uncharacterized protein |
| Sequence | MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKVREASLRGRCSLSKQFIKSGHRKWGSLELERQFPKGGDAGR |
| Length | 157 |
| Position | Tail |
| Organism | Ursus americanus (American black bear) (Euarctos americanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ursus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.549 |
| Instability index | 30.56 |
| Isoelectric point | 9.39 |
| Molecular weight | 17600.76 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23862
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.64| 14| 24| 33| 55| 1
---------------------------------------------------------------------------
33- 46 (25.01/32.99) DCLKDGMRNKETLE
58- 71 (23.63/ 8.56) DNLHSVNRDLNELE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.43| 16| 24| 98| 113| 2
---------------------------------------------------------------------------
98- 113 (29.03/18.29) QDKTPLYSQLLQA..YKW
123- 140 (24.40/14.50) RGRCSLSKQFIKSghRKW
---------------------------------------------------------------------------
|