<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23860
Description |
Mediator complex subunit 28 |
Sequence | MAAALSGMFTNQPPGAPPPPLPPGGPGQAGLLPAAAGPRNPNSTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLHLSVQKPELVIKEDVSELKNELQRKEALIQKHLGKLRHWQQVLEDMNVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
Length | 179 |
Position | Head |
Organism | Gopherus agassizii (Agassiz's desert tortoise) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Testudines> Cryptodira> Durocryptodira> Testudinoidea>
Testudinidae> Gopherus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.451 |
Instability index | 51.67 |
Isoelectric point | 5.58 |
Molecular weight | 19643.24 |
Publications | PubMed=28562605
|
Function
Annotated function |
|
GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP23860
No repeats found
|