<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23853
| Description |
Mediator complex subunit 29 |
| Sequence | MLTKTGRRTCDALPVREAKKMAASQQQASATSSTASVSGPGSAGGSGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQKEQRWTHSAL |
| Length | 102 |
| Position | Tail |
| Organism | Capra hircus (Goat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Caprinae> Capra.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.780 |
| Instability index | 83.33 |
| Isoelectric point | 9.89 |
| Molecular weight | 10942.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP23853
No repeats found
|