<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23845
| Description |
mediator of RNA polymerase II transcription subunit 14-like |
| Sequence | MISSFLDQQAILFVDTADRLASLARDALVPARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVYSMQINFIHQLVQSRLFADEKPLQDMYSCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENCRLF |
| Length | 316 |
| Position | Tail |
| Organism | Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Mysticeti>
Balaenopteridae> Balaenoptera.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.108 |
| Instability index | 33.65 |
| Isoelectric point | 6.83 |
| Molecular weight | 35820.14 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23845
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.67| 25| 32| 166| 197| 1
---------------------------------------------------------------------------
152- 179 (33.69/20.24) SMQINFIHQlvQSRLFADEKpLQDMYSC
186- 210 (41.98/35.86) SLQLEVLHS..QTLMLIRER.WGDLVQV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.89| 24| 32| 11| 34| 2
---------------------------------------------------------------------------
11- 34 (38.69/23.07) ILFVDTADRLASLARDALVPARLP
44- 64 (37.15/21.90) VLTTGSYPRLPTCIRDKIIP...P
75- 93 (25.06/12.71) .....TLHQLNQILRHRLVTTDLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.75| 12| 30| 243| 254| 3
---------------------------------------------------------------------------
243- 254 (20.47/13.11) IKIDENDVSKPL
274- 285 (20.28/12.93) MKIDHLSIEKLL
---------------------------------------------------------------------------
|