<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23839
Description |
Mediator of RNA polymerase II transcription subunit 25 |
Sequence | MAAKRLIVVVESTAAMGPYWETILRDYLDKIIRCFGENVSTVQNSSSSVEFALVSYNTHGCYSDCLVQRTGWTRDPDVFFLWLSSIPFSGGGFNDAVIAEGLAEALMMFPNSQSGDPNQQNVEIHQHCILVAASNPYPLRTPICVPQLQNLEQSETIESFPGNCLYDAEAVAKAFPQFSISLSVICPKQLPKIKAIYNAVRMAYHSSTKILTSLYVYF |
Length | 218 |
Position | Unknown |
Organism | Glycine soja (Wild soybean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.079 |
Instability index | 44.33 |
Isoelectric point | 5.32 |
Molecular weight | 24208.42 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP23839
No repeats found
|