<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23816

Description U-box domain-containing protein 33 isoform C
SequenceMDCIEKGIVELISRYGIQKLVMGAASDKYHSRRMTSLRSKKAIYVCEQAPASCHIQFICNGYLIHTRDCSLNRGNVEVEFPLLQQMANSEVGHSPNLSFQSILQGQNHGIKLTNPAQELFRRVRSVNDGHMRSLESVSSSEGFLTPPSKFSKNISSIEPGLTPNLINDGSENALDLILNDPSLINKDLHHSSSPSVLDEGMDDALYHQLEQVMAEASNARRDAYQETVRRGKAEKDAIDAIHRAKATENLYKEELKLRKEQEEAVEKANEKLNNMKSQTDKVNEELRLALDQNSSLENQIASTELMVKELKQKIIFSLDLLQNYKDELDDLQIQRDNAVGEAEEFRRKQGEASSSTQELHCFSDFSFQEIKEATSNFNPSKKIGEGGYGSIFKGVLRHTEVAIKMLNPDSTQGPLEFQQEVEVLSKLRHPNLITLIGACTESWTLVYEYLPNGSLEDRLNRKDNTPPLSWQTRICIAAELCSALNFLHSNKPHSIAHGDLKPANILLDANLVSKLSDFGICRILSCQDSSSNSTTQFWRTVPKGTFVYVDPEFLASGELTPKSDVYSFGIILLRLMTGKPALGIIKEVQYALDAGKLKSILDPLAGEWPFMLAEELIRLALRCCEMNRKNRPELYSDVWRILEPMRASSVVTNTSQLGSQRLCQPPPYFICPIFLEVMQDPHVASDGFTYEAEAIREWLESGRDTSPRTNSKLAHHNLVPNHALRHAIQNWLQSQ
Length735
PositionTail
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.07
Grand average of hydropathy-0.441
Instability index42.31
Isoelectric point5.79
Molecular weight82699.78
Publications









Function






Annotated function

Functions as an E3 ubiquitin ligase.



ECO:0000256	ARBA:ARBA00003861

GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP23816
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.70|      32|     186|     464|     498|       1
---------------------------------------------------------------------------
  464-  498 (52.71/56.19)	NTPPLSWQtRICIAAE..LCSAlnFLHSNK.PHSIAHG
  653-  687 (52.99/42.52)	NTSQLGSQ.RLCQPPPyfICPI..FLEVMQdPHVASDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      99.44|      30|      30|     232|     261|       2
---------------------------------------------------------------------------
  232-  261 (47.21/32.60)	KAEKDAI....DAIHRAKATENLYKEELKLRKEQ
  263-  292 (26.67/15.32)	....EAVekanEKLNNMKSQTDKVNEELRLALDQ
  308-  328 (25.57/14.40)	KELKQKI......IFSLDLLQN.YKDEL......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.24|      10|      15|     137|     146|       3
---------------------------------------------------------------------------
  137-  146 (18.90/14.17)	VSSSEGFLTP
  154-  163 (19.35/14.72)	ISSIEPGLTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     194.75|      62|     265|      67|     135|       4
---------------------------------------------------------------------------
   67-  135 (95.83/78.23)	RDCSLnrGNVEvEFPLLQQMANS...EVGHSPNLSFQSILQGQNHgiklTNPAQELFR.RVRSVNDGHMRSLE
  335-  400 (98.93/61.56)	RDNAV..GEAE.EFRRKQGEASSstqELHCFSDFSFQEIKEATSN....FNPSKKIGEgGYGSIFKGVLRHTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.50|      16|      16|     165|     180|       6
---------------------------------------------------------------------------
  165-  180 (27.14/15.07)	LIND.....GSENALDLILND
  183-  203 (22.36/11.32)	LINKdlhhsSSPSVLDEGMDD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP23816 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YKEELKLRKEQEEAVEKANEKLNNMKSQTDKVNEELRLA
251
289










Molecular Recognition Features






MoRF SequenceStartStop




NANANA