<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23806
Description |
Mediator of RNA polymerase II transcription subunit 32 isoform A |
Sequence | MLWCGWFYSTPWAYNLPPLMGMQQWTVRVFAGENSREILKDERFTVFLVFDLGEGGVRRGDRRGEGRGYVGGVEEDVGLSPTTVRNLLTVLDAVKVGDDRFHGNGNKEKGGVFGHQCNHDEGGSVITRSLDLTQAGTMDSIVDSLNNAYQDFVAAAANVLEAKENAGSIKTMATDTALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATRPVAGKPGQATMTGLPPISAVRLEQMSKAVRWLVIELQHGSGAGSANSALTHPSAPFDARFSEDAAQ |
Length | 283 |
Position | Tail |
Organism | Glycine soja (Wild soybean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.309 |
Instability index | 40.44 |
Isoelectric point | 5.07 |
Molecular weight | 30817.20 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23806
No repeats found
|