<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23801
| Description |
Mediator of RNA polymerase II transcription subunit 19a isoform E |
| Sequence | MDPDSKKFGGGPRELTGSVDLLNHFKLLPHFEFFCKRPLPVSISDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYRIQPLDLDILKEAFLLKETVPIDLPAAEKGILTVAGKSKGESKDEEKKHKKHKDRDKDKDKEHKKHKHRQKDRSKDKEKEKKKDKNRHHDSSADPSKKHNEKKRKHDGDDDLNVVHKHKKSKHKSSKIDELGAIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.272 |
| Instability index | 34.36 |
| Isoelectric point | 9.41 |
| Molecular weight | 25027.10 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23801
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.48| 16| 16| 140| 155| 2
---------------------------------------------------------------------------
140- 155 (31.24/12.38) KDKEHKKHKHRQKDRS
158- 173 (28.25/10.51) KEKEKKKDKNRHHDSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.46| 14| 16| 180| 193| 3
---------------------------------------------------------------------------
180- 193 (26.65/12.19) HNEKKRKHDGD..DDL
197- 212 (20.81/ 7.96) HKHKKSKHKSSkiDEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.91| 13| 16| 49| 61| 6
---------------------------------------------------------------------------
49- 61 (21.37/16.03) LYNVVGDIEIRKG
66- 78 (20.54/15.16) LDQLIQDTSLSSG
---------------------------------------------------------------------------
|