<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23798
| Description |
Mediator of RNA polymerase II transcription subunit 19a isoform A |
| Sequence | MDPDSKKFGGGPRELTDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYRIQPLDLDILKEAFLLKETVPIDLPAAEKGILTVAGKSKGESKDEEKKHKKHKDRDKDKDKEHKKHKHRQKDRSKDKEKEKKKDKNRHHDSSADPSKKHNEKKRKHDGDDDLNVVHKHKKSKVIKGEALSPDKFSIFHSHLFLLYKLSAVYCFS |
| Length | 207 |
| Position | Head |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.274 |
| Instability index | 32.29 |
| Isoelectric point | 9.35 |
| Molecular weight | 23811.69 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23798
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.34| 14| 15| 129| 143| 2
---------------------------------------------------------------------------
129- 143 (21.91/11.85) DKEKeKKKDKNRHHD
147- 160 (25.43/10.42) DPSK.KHNEKKRKHD
---------------------------------------------------------------------------
|