<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23780
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQHQIVQSPAMLGLANPNSPSIPNPTPPKLPPTQTHHPQDRNSSTPSSALLSLLPPHPRAQALLAQMASLASKLFEVSPNRSLWVTAFRGSLPTFLSSHSSTPLDTSPSDGKEIISLLTVLQTQIFEAIAELQEILDLQDAKQKIDCEIHSQDSTLLAFANKLKEAESCLDILVDDYSDYHRSKRSKSGDDDSMTSSTISSQLKLSDMLSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQLYNFADLDVGLPKEVETKEKIVEAIVEPAPQVDTNTVPNLSAFQGMLPPMPPGWKPGMPVQLPIDLPLPPPGWKPGDPVPLPPMDSLQIPRFAEQQMQPHIPQPKQPEVIQVQPVNLDLGGSDTSDYSSDDASSDDED |
| Length | 388 |
| Position | Middle |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.428 |
| Instability index | 62.33 |
| Isoelectric point | 4.66 |
| Molecular weight | 42227.16 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP23780
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.22| 16| 18| 301| 318| 1
---------------------------------------------------------------------------
297- 313 (35.52/16.52) LPPmPPGWKPGMPVQLP
316- 332 (34.71/11.04) LPLpPPGWKPGDPVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.83| 22| 203| 171| 193| 2
---------------------------------------------------------------------------
171- 193 (36.26/21.42) LDILVDDYSDYHrSKRSKSGDDD
367- 388 (39.57/19.57) LDLGGSDTSDYS.SDDASSDDED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.11| 32| 37| 223| 254| 4
---------------------------------------------------------------------------
223- 254 (56.88/28.63) PPEFGAGQAPLRGALPPAPQEEQMRASQLYNF
262- 293 (50.23/24.56) PKEVETKEKIVEAIVEPAPQVDTNTVPNLSAF
---------------------------------------------------------------------------
|