<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP23772
Description |
Mediator of RNA polymerase II transcription subunit 19a isoform G |
Sequence | MLFKILGPRELTGAVDLLNHFQLLPHFEFFCKRPLPVSISDAHYLYNVVGDIEIRKGDGMQLDQLIQDTSLSSGSNYHIQPLDLDILKEAFQLKETVPIDLPAAEKGILTVAGKSKGESKDVEKKHKKHKDRDKDKDKEHRKHKHRQKDQTKDKEKEKKKDKNRHHDSSADPSKKHHEKKRKHGGDDDLNGVHKHKKVR |
Length | 199 |
Position | Head |
Organism | Glycine soja (Wild soybean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.208 |
Instability index | 31.81 |
Isoelectric point | 9.44 |
Molecular weight | 23001.92 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP23772
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 92.55| 16| 47| 114| 129| 2
---------------------------------------------------------------------------
114- 129 (27.15/10.76) KSK..GESKDVEKKHKKH
146- 161 (23.61/ 8.55) RQK..DQTKDKEKEKKKD
162- 179 (20.74/ 6.76) KNRhhDSSADPSKKHHEK
180- 196 (21.05/ 6.95) KRK.hGGDDDLNGVHKHK
---------------------------------------------------------------------------
|